PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015883277.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 318aa    MW: 34567.9 Da    PI: 7.8236
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015883277.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-382988261
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  XP_015883277.1 29 NHQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 88
                    57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-272782IPR003851Zinc finger, Dof-type
PfamPF027012.8E-333187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MQDIHSIGGG RFFGGGTGDR RLRPHHHQNH QALKCPRCDS LNTKFCYYNN YNLSQPRHFC  60
KSCRRYWTKG GVLRNVPVGG GCRKTKRSKP KASSATTSTP SPPPPVALER KSNSHSSSES  120
SSLTANNTNA TATTEAVSAP STSSASNLLN IQESKFFVAQ NSNPSFESTL LEQGSDCGIF  180
SEIGSFTSLI TSSAATEAMP FGYSNISDIS ISPFRLNQQG QDNQVQQTQW HQQSQKAGMS  240
ISDQELKMQE ITGGLLDQTA QVDLSGLQNR SGGGGFGSLG DWQPGGDQGL FDLTNTVDQT  300
YWSQSQWTDQ DHPSLYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815GGRFFGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883277.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLW9RP281e-142W9RP28_9R
STRINGVIT_17s0000g04850.t017e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.18e-34OBF binding protein 4